Skip to product information
1 of 1

Human NY-BR-1, His tag

Human NY-BR-1, His tag

Catalog Number: S0A6028 Brand: Starter
Price:
Regular price $170 USD
Regular price Sale price $170 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms ANKRD30A
Accession Q9BXX3
Amino Acid Sequence Protein sequence(Q9BXX3, Arg851-Leu928, with C-10*His)RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:10.6kDa Actual:13-20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

ANKRD30A has been previously identified as NY-BR-1 or antigen B726P. It was identified based on spontaneous humoural immune responses in breast cancer patients (Jäger et al. 2001, 2002). The protein is regarded as a putative transcription factor, as it contains a bipartite nuclear localization signal motif and a bZIP site (DNA-binding site followed by leucine zipper motif). Additional structural features include five tandem ankyrin repeats, implying a role for ANKRD30A in protein–protein interactions. In view of its highly restricted expression pattern, ANKRD30A may be considered as a breast differentiation antigen that could represent a suitable target for immunotherapy. Indeed, it was found in 80% of breast cancer specimens, while tumours of other histological types were ANKRD30A-negative. It was also identified in normal breast, normal testis, was inconsistent in prostate, and not found in other tissues.

Picture

SDS-PAGE

2μg(R: reducing conditions)