Skip to product information
1 of 1

Human NTB-A/SLAMF6/CD352 Protein, hFc tag

Human NTB-A/SLAMF6/CD352 Protein, hFc tag

Catalog Number: S0A5006 Brand: Starter
Price:
Regular price $335 USD
Regular price Sale price $335 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms SLAM family member 6, Activating NK receptor, NK-T-B-antigen (NTB-A), CD352, SLAMF6, KALI
Accession Q96DU3
Amino Acid Sequence

Protein sequence (Q96DU3, Asn31-Gly239, with C-hFc tag) NGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFG

Expression System HEK293
Molecular Weight

Predicted MW: 49.6 kDaObserved MW: 60-70 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

SLAM family member 6 is a protein that in humans is encoded by the SLAMF6 gene. The protein is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. It is expressed on natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

Picture

SDS-PAGE

2μg(R: reducing conditions)