Skip to product information
1 of 1

Human CD59, His tag

Human CD59, His tag

Catalog Number: S0A1034 Brand: Starter
Price:
Regular price $170 USD
Regular price Sale price $170 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 1F5 antigen, 20 kDa homologous restriction factor (HRF-20; HRF20), MAC-inhibitory protein (MAC-IP), MEM43 antigen, Membrane attack complex inhibition factor (MACIF), Membrane inhibitor of reactive lysis (MIRL), Protectin
Accession P13987
Amino Acid Sequence

Protein sequence(P13987, Leu26-Asn102, with C-10*His)LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:10.6kDa Actual:11, 15kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD59 glycoprotein, also known as MAC-inhibitory protein (MAC-IP), membrane inhibitor of reactive lysis (MIRL), or protectin, is a protein that in humans is encoded by the CD59 gene. CD59 attaches to host cells via a glycophosphatidylinositol (GPI) anchor. When complement activation leads to deposition of C5b678 on host cells, CD59 can prevent C9 from polymerizing and forming the complement membrane attack complex. It may also signal the cell to perform active measures such as endocytosis of the CD59-C9 complex. Viruses such as HIV, human cytomegalovirus and vaccinia incorporate host cell CD59 into their own viral envelope to prevent lysis by complement.

Picture

SDS-PAGE

2μg(R: reducing conditions)