Skip to product information
1 of 2

Human CD3 delta Protein, His Tag

Human CD3 delta Protein, His Tag

Catalog Number: S0A1042 Brand: Starter
Price:
Regular price $45 USD
Regular price Sale price $45 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, CD3d
Accession P04234
Amino Acid Sequence

Protein sequence(P04234, Phe22-Ala105, with C-10*His)FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 11.2 kDaObserved MW: 18-25 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD3 delta is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene.

Picture

Bioactivity

Immobilized CD3 epsilon Fc Chimera Protein, Human (Cat. No. UA010199) at 2 μg/mL (100 μL/well) can bind Human CD3 delta, His tag with EC50 of 3.8-4.6 μg/ ml.

SDS-PAGE

2μg(R: reducing conditions)