2e5 of transient transfected anti-BCMA ScFv CAR-293 cells were stained with 1ug Human BCMA/TNFRSF17 Protein, His Tag and unlable respectively (Fig. C and B), and non-transfected 293 cells were used as a control (Fig. A). Alexa Fluor 647 signal was used to evaluate the binding activity. 2e5 of transient transfected anti- BCMA ScFv CAR-293 cells were stained with isotype and Whitlow/218 Linker-Alexa Fluor® 488 (Fig. E and D). Alexa Fluor® 488 signal was used to evaluate the binding activity.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA |
| Accession | Q02223-1 |
| Amino Acid Sequence | Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 5.9 kDaObserved MW: 10, 13 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Picture
Picture
FC
Bioactivity
Immobilized Human BCMA/TNFRSF17 Protein, His Tag at 2 μg/mL (100 μL/well) can bind Human TNFSF13B/BAFF/CD257 Protein, hFc tag (Cat. No. S0A1143) with EC50 of 4.5-6.2 ng/ml.
SDS-PAGE
2μg(R: reducing conditions)
