HBV Surface Antigen-preS2,2μg on SDS-PAGE under Non-reducing and reducing condition. The purity is greater than 95%.
Product Details
Product Details
Product Specification
| Species | HBV |
| Synonyms | Middle surface antigen; PreS2 |
| Amino Acid Sequence | MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN |
| Expression System | E.coli |
| Molecular Weight | 5.8 kDa(Reducing) |
| Purity | >95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | 20mM PB, 50mM NaCl, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).
Picture
Picture
SDS-PAGE

