Skip to product information
1 of 1

FSH α&β Heterodimer His Tag Protein, Human

FSH α&β Heterodimer His Tag Protein, Human

Catalog Number: UA030065 Brand: UA BIOSCIENCE
Price:
Regular price $376 USD
Regular price Sale price $376 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms FSH alpha/beta,FSH
Accession P01215 (FSH alpha) & P01225 (FSH beta)
Amino Acid Sequence

Ala25-Ser116 (FSH alpha)APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSAsn19-Glu129 (FSH beta)NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-25kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Walter Vegetti. FSH and folliculogenesis: from physiology to ovarian stimulation. Reprod Biomed Online.2006 Jun;12(6):684-94.

Background

FSH is a glycoprotein hormone consisting of two peptide subunits. The role of FSH in folliculogenesis is well known: to stimulate the formation of a large pre-ovulatory follicle that, because of its FSH-dependent maturation, is capable of ovulation and forming a corpus luteum in response to the mid-cycle surge of LH. FSH is widely used in ovarian stimulation for assisted reproduction techniques. Ovarian stimulation protocols combine the use of human menopausal gonadotrophin, urinary FSH or recombinant FSH with gonadotrophin-releasing hormone (GnRH) agonists or antagonists in order to increase oocyte number and to avoid premature LH surge.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).