Skip to product information
1 of 1

Human SV2A Protein, His Tag

Human SV2A Protein, His Tag

Catalog Number: S0A0215 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736
Accession Q7L0J3
Amino Acid Sequence

Protein sequence (Q7L0J3, Try480-Thr590, with C-His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT

Expression System HEK293
Molecular Weight Predicted MW: 14.7 kDaObserved MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Synaptic Vesicle Glycoprotein 2A (SV2A) is a membrane protein found in all synaptic vesicles, the organelles responsible for storing neurotransmitters in neurons. It is the ubiquitous and primary isoform of the SV2 family. SV2A plays a critical role in regulating the exocytotic release of neurotransmitters. It is essential for priming synaptic vesicles, a process that makes them ready for calcium-triggered fusion with the presynaptic membrane. It is the direct molecular target for the anti-epileptic drug levetiracetam, underscoring its therapeutic significance in modulating neuronal excitability.

Picture

SDS-PAGE

4μg(R: reducing conditions)