Skip to product information
1 of 2

Human IL-17A, His tag

Human IL-17A, His tag

Catalog Number: S0A4023 Brand: Starter
Price:
Regular price $170 USD
Regular price Sale price $170 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8)
Accession Q16552
Amino Acid Sequence

Protein sequence(Q16552, Gly24-Ala155, with C-10*His)GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8kDa Actual:17, 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Picture

Bioactivity

Immobilized Recombinant Human IL-17RA (C-Fc) at 4 μg/mL (50 μL/well) can bind Human IL-17A, His tag with EC50 of 5.019-5.731 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)