Human IL-10 Protein, His Tag

Catalog Number: S0A4001 Brand: Starter

Price:

$300 USD

Size: 50μg 100μg 500μg

Quantity:

For shipping services or bulk orders, you may request a quotation.

Secure checkout with

View full details

Product Details

Product Specification

Species	Human
Synonyms	Interleukin-10, Cytokine synthesis inhibitory factor (CSIF), IL10
Accession	P22301
Amino Acid Sequence	Protein sequence (P22301, Ser26-Asn178, with C-His Tag) SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Molecular Weight	Predicted MW: 19.7 kDaObserved MW: 19.7 kDa
Purity	＞90% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

IL-10 (Interlukin-10) is a multicellular and multifunctional cytokine that regulates cell growth and differentiation, participates in inflammatory and immune responses, and is recognized as an inflammatory and immunosuppressive factor. It plays an important role in tumor, infection, organ transplantation, hematopoietic system and cardiovascular system, and is closely related to diseases of blood, digestion, especially cardiovascular system.Overexpression of IL-10 leads to skin leishmaniasis, and IL-10 plays a decisive role in the development of immune paralysis, temporary immune deficiency after trauma, major surgery, burns, shock and high risk bacterial/fungal infections that can be fatal. Macrophage-derived IL-10 is also associated with age-related immune deficiency.Continuous immune activation occurs when IL-10 is relatively or absolutely deficient, which can lead to chronic inflammatory bowel diseases (such as Crohn's disease), psoriasis, rheumatoid arthritis and post-transplant disease, etc.This product is the recombinant human IL-10 protein expressed from human 293 cells (HEK293).

Picture

Bioactivity

Immobilized Human IL-10 Protein, His Tag at 20 μg/mL (50 μL/well) can bind Active Recombinant Human IL-10 R alpha/IL10RA/CD210 Protein with EC50 of 29.35-35.61 ng/mL.