Skip to product information
1 of 4

TRKB(NTRK2) Protein

TRKB(NTRK2) Protein

Catalog Number: UA080132 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $767 USD
Regular price Sale price $767 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms NTRK2,TRKB
Accession Q548C2
Amino Acid Sequence

L456-G822(end)

LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

Expression System Baculovirus-InsectCells
Molecular Weight 68.1 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 1mM DTT, 10% glycerol, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Picture

Bioactivity

TRKB titration in HTRF assay

The TRKB activity was detected using HTRF technology. The reaction was performed by incubating the TRKB protein , ATP and substrate at 25℃ for 60 min, adding the beads at 25℃ for 60 min, then reading ratio 665/620 with BMG.

SDS-PAGE

SEC-HPLC