Skip to product information
1 of 1

Human IGFBP-1, His Tag

Human IGFBP-1, His Tag

Catalog Number: S0A0008 Brand: Starter
Price:
Regular price $535 USD
Regular price Sale price $535 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IBP-1, IGF-binding protein 1, Placental protein 12 (PP12)
Accession P08833
Amino Acid Sequence

Protein sequence (P08833, Ala26-Asn259 with C-10*His)APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 26.9kDaActual: 30kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Insulin-like growth factor-binding protein 1 (IBP-1) also known as placental protein 12 (PP12) is a protein that in humans is encoded by the IGFBP1 gene. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Serum IGFBP-1 provided high diagnostic accuracy of early-stage ESCC, EJA, stomach and cancer.

Picture

Bioactivity

Immobilized Human IGFBP-1, His Tag at 2 μg/mL (100 μL/well) can bind IGFBP1 Recombinant Rabbit mAb (SDT-196-47) (Cat. No. S0B0225) with EC50 of 1.5-2.5 ng/ml.

SDS-PAGE

2μg (R: reducing conditions)