Skip to product information
1 of 1

Human HE4 Protein, His Tag

Human HE4 Protein, His Tag

Catalog Number: S0A6003 Brand: Starter
Price:
Regular price $300 USD
Regular price Sale price $300 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms WAP four-disulfide core domain protein 2, Epididymal secretory protein E4, Major epididymis-specific protein E4, Putative protease inhibitor WAP5, WFDC2
Accession Q14508
Amino Acid Sequence

Protein sequence (Q14508, Glu31-Phe124, with C-His Tag) EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Molecular Weight Predicted MW: 11.7 kDaObserved MW: 15, 20-24 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

HE4 (human epididymis protein 4) is a new tumor marker for ovarian cancer, and the incidence of ovarian cancer ranks third among the three gynecological malignancies. Early diagnosis is crucial to the cure rate of ovarian cancer. Normally, HE4 is expressed at very low levels in humans, but it can be very high in the tissues and serum of ovarian cancer patients and has a high sensitivity for ovarian cancer detection, especially in the early asymptomatic stage.This product is the recombinant human HE4 protein expressed from human 293 cells (HEK293).

Picture

SDS-PAGE

1μg(R: reducing conditions)